Recombinant Proteins
Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
Recombinant
- (285)
- (11)
- (65,867)
- (1)
For Use With (Application)
- (2)
- (970)
- (1)
- (23,540)
- (5)
- (1)
- (1)
- (67)
- (216)
- (4,420)
- (23)
- (1)
- (4)
- (2)
- (13)
- (21,448)
- (3)
- (4)
- (3)
- (1)
- (2)
- (4)
- (14)
- (71)
- (2)
- (2)
- (2)
- (1)
- (3)
- (2)
- (1)
- (157)
- (3)
- (4)
- (1)
- (1)
- (1)
- (3)
- (253)
- (22,591)
- (1)
- (1)
- (2)
- (1)
- (13)
- (26,799)
- (253)
- (32)
- (3)
- (708)
- (14)
- (2)
- (1)
- (8)
- (1)
- (5)
- (1)
- (105)
- (1)
- (3,750)
- (1,407)
- (3)
- (4)
- (5)
- (1)
- (1)
- (1)
- (1)
- (14)
- (138)
- (48)
- (6)
- (17)
- (2)
- (1)
- (10)
- (4)
- (81)
- (12)
- (2)
- (3)
- (80)
- (4)
- (113)
- (96)
- (19)
- (1)
- (1)
- (4)
- (1)
- (1,522)
- (2)
- (1)
- (160)
- (18)
- (48)
- (3)
- (3)
- (1)
- (2)
- (9)
- (27)
- (2)
- (208)
- (1)
- (4)
- (1)
- (2)
- (114)
- (44)
- (2)
- (1)
- (1)
- (4)
- (1)
- (1)
- (3)
- (1)
- (23,708)
- (6)
- (3)
- (1)
- (1)
- (63)
- (6)
- (2)
- (7)
- (5)
- (1)
- (2)
- (1)
- (1)
- (6,758)
- (6)
- (4)
- (1)
- (3)
- (1)
- (3)
- (2)
- (13)
- (17)
- (1)
- (3)
- (3)
- (4)
- (27,095)
- (235)
- (1)
- (3)
Species
- (2)
- (1)
- (2)
- (1)
- (89)
- (559)
- (96)
- (2)
- (1)
- (1)
- (2)
- (1)
- (27)
- (1)
- (8)
- (15)
- (1)
- (72)
- (1)
- (1,303)
- (1)
- (3)
- (16)
- (1)
- (3)
- (1)
- (1)
- (1)
- (8)
- (1)
- (4)
- (1)
- (1)
- (29,092)
- (5)
- (22)
- (8)
- (4)
- (1,291)
- (2)
- (1)
- (1)
- (3)
- (1)
- (1)
- (8)
- (14)
- (32)
- (24)
- (1)
- (2)
- (16)
- (233)
- (9)
- (2)
- (5)
- (1)
- (2)
- (2)
- (2)
- (23)
- (5)
- (3)
- (3)
- (2)
- (14)
- (23,574)
- (1)
- (48)
Form
- (15)
- (1)
- (2)
- (45,208)
- (5,648)
- (245)
- (168)
- (56)
- (3,361)
Conjugate
- (7)
- (1)
- (3)
- (18)
- (2)
- (62)
- (1)
- (4)
- (2)
- (9)
- (59)
- (1)
- (2)
- (3)
- (1)
- (391)
- (1)
- (3)
- (2)
- (1)
- (1)
- (1)
- (3)
- (2)
- (3)
- (19)
- (7)
- (2)
- (2)
- (3)
- (45)
- (1)
- (1)
- (1)
- (2)
- (5)
- (1)
- (1)
- (1)
- (2)
- (8)
- (2)
- (3)
- (43,090)
- (1)
- (11)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
Search Within Results
Keyword Search:
Clear All
451
–
465
of
119,908
results
451
Invitrogen™ Human GSK-3B (GSK3 beta), His Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | RUO - research use only |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| Molecular Weight (g/mol) | 53.1 kDa |
| Formulation | 50 mM tris with 0.01% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5 |
| Sequence | Full length |
| Concentration | See Label |
| For Use With (Application) | Kinase Assay |
| Name | Human GSK-3 B (GSK3 beta), His Tag |
| Recombinant | Recombinant |
452
Invitrogen™ Human PAK1, GST Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | For research use only. Not for use in diagnostic procedures |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| Molecular Weight (g/mol) | 88.1 kDa |
| Formulation | 50 mM tris with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5 |
| Sequence | Full length |
| Concentration | See Label |
| For Use With (Application) | Kinase Assay |
| Name | Human PAK1, GST Tag |
| Recombinant | Recombinant |
453
Invitrogen™ Human CDK4/cyclin D3, GST Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Conjugate | Unconjugated |
|---|---|
| Form | Liquid |
| pH Range | 7.5 |
| Common Name | CDK4/Cyclin D3 |
| Molecular Weight (g/mol) | 60.0-58.8 kDa |
| KinaseFamily | CDKs and CHKs |
| Expression System | Insect cells |
| For Use With (Application) | Kinase Assay |
| Name | Human CDK4/cyclin D3, GST Tag |
| Purification Method | Purified |
| Gene Alias | Cdk4; Cell division protein kinase 4; CMM3; Crk3; cyclin dependent kinase 4; cyclin-dependent kinase 4; MGC14458; PSK-J3; serine/threonine kinase; Unknown (protein for MGC:133903) |
| Protein Form | Full Length, Recombinant, Active |
| Formulation | 50mM tris HCl with 0.1mM PMSF, 150mM NaCl, 0.1mM EDTA, 0.25mM DTT, 25% glycerol, 10mM glutathione and no preservative; pH 7.5 |
| Species | Human |
| Recombinant | Recombinant |
| Shipping Condition | Dry Ice |
| Content And Storage | -80°C, Avoid Freeze/Thaw Cycles |
| Gene Symbol | CCND3, CDK4 |
| Sequence | CDK4: 1-303, Cyclin D3: 1-292 |
| Storage Requirements | -80°C, Avoid Freeze/Thaw Cycles |
| Concentration | See Label |
| Accession Number | P11802, P30281 |
| Regulatory Status | RUO |
| Product Type | Protein |
| Gene ID (Entrez) | 1019, 896 |
| Protein Tag | GST-tag |
454
Invitrogen™ Human ZAP-70, His Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| Common Name | Zap-70 |
| Molecular Weight (g/mol) | 70.1 kDa |
| KinaseFamily | SYK Kinase Family |
| Sequence | Full length |
| Concentration | See Label |
| Expression System | Baculovirus |
| For Use With (Application) | Kinase Assay |
| Name | Human ZAP-70, His Tag |
| Accession Number | P43403 |
| Gene ID (Entrez) | 7535 |
| Protein Tag | His-tag |
| Species | Human |
| Recombinant | Recombinant |
455
Invitrogen™ Human Lck, His Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Conjugate | Unconjugated |
|---|---|
| Form | Liquid |
| pH Range | 7.5 |
| Common Name | LCK |
| Molecular Weight (g/mol) | 60.6 kDa |
| Gene Symbol | LCK |
| Concentration | See Label |
| Expression System | Insect cells |
| For Use With (Application) | Kinase Assay |
| Accession Number | P06239 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | EC 2.7.10.2; Hck-3; IMD22; kinase Lck; Lck; LCK proto-oncogene, Src family tyrosine kinase; Lck1; Lcktkr; leukocyte C-terminal Src kinase; LSK; Lskt; Lsk-t; Lymphocyte cell-specific protein-tyrosine kinase; lymphocyte protein tyrosine kinase; lymphocyte-specific protein tyrosine kinase; OTTHUMP00000008640; OTTHUMP00000008740; OTTHUMP00000008741; p56(LSTRA) protein-tyrosine kinase; p56>lck>; p56lck; p56-LCK; pp58lck; Protein YT16; Proto-oncogene Lck; Proto-oncogene tyrosine-protein kinase LCK; RP4-675E8.4; t cell-specific protein-tyrosine kinase; T-lymphocyte specific protein tyrosine kinase p56lck; tyr; tyrosine-protein kinase Lck; YT16 |
| Product Type | Protein |
| Gene ID (Entrez) | 3932 |
| Protein Tag | His-tag |
| Species | Human |
| Recombinant | Recombinant |
456
Invitrogen™ Human FGFR1, His Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | For research use only. Not for use in diagnostic procedures |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| Molecular Weight (g/mol) | 50.4 kDa |
| Formulation | 50 mM tris with 0.05% Triton X-100, 0.2 mM EDTA, 100 mM NaCl, 50% glycerol, 5 mM DTT and no preservative; pH 7.5 |
| Concentration | See Label |
| For Use With (Application) | Kinase Assay |
| Name | Human FGFR1, His Tag |
| Recombinant | Recombinant |
457
Invitrogen™ Human uPAR (aa 51-156) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | VRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGE |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human uPAR (aa 51-156) Control Fragment |
| Recombinant | Recombinant |
458
Invitrogen™ Human AKT2 (PKB beta), His Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | For research use only. Not for use in diagnostic procedures |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| Molecular Weight (g/mol) | 59.1 kDa |
| Formulation | 20 mM tris with 0.01% Triton X-100, 0.1 mM sodium orthovanadate, 0.5 mM EDTA, 150 mM NaCl, 20% glycerol, 2 mM DTT and no preservative; pH 7.5 |
| Sequence | Full length |
| Concentration | See Label |
| For Use With (Application) | Kinase Assay |
| Name | Human AKT2 (PKB beta), His Tag |
| Recombinant | Recombinant |
459
Invitrogen™ Human CASK, GST Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | -80°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| Common Name | CASK |
| Molecular Weight (g/mol) | 91 kDa |
| Concentration | See Label |
| Expression System | Baculovirus |
| For Use With (Application) | Kinase Assay |
| Name | Human CASK, GST Tag |
| Accession Number | O14936 |
| Gene Alias | CAGH39; calcium/calmodulin dependent serine protein kinase; calcium/calmodulin-dependent serin protein kinase; Calcium/calmodulin-dependent serine protein kinase; calcium/calmodulin-dependent serine protein kinase (MAGUK family); calcium/calmodulin-dependent serine protein kinase membrane-associated guanylate kinase; CAMGUK; CASK; CMG; DXPri1; DXRib1; FGS4; G-protein-coupled receptor GPR34; hCASK; LIN2; LIN-2; MGC7449; MICPCH; mLin-2; MRXSNA; OTTHUMP00000023157; OTTHUMP00000023161; OTTHUMP00000023162; Pals3; peripheral plasma membrane protein CASK; Protein lin-2 homolog; RP23-278L4.1; TNRC8; trinucleotide repeat containing 8 |
| Protein Length | 1-570 |
| Gene ID (Entrez) | 8573 |
| Protein Tag | GST-tag |
| Species | Human |
| Recombinant | Recombinant |
460
Invitrogen™ Human ACVR2A, GST Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | -80°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| Common Name | ACVR2A |
| Molecular Weight (g/mol) | 85.3 kDa |
| KinaseFamily | STKR Kinase Family |
| Sequence | Full length |
| Concentration | See Label |
| Expression System | Insect cells |
| For Use With (Application) | Kinase Assay |
| Name | Human ACVR2A, GST Tag |
| Accession Number | P27037 |
| Gene Alias | activin A receptor type 2 A; activin A receptor type IIA; activin A receptor, type IIA; activin receptor IIA; activin receptor type IIA; Activin receptor type-2 A; Actrii; ActrIIa; ACTR-IIA; ACVR2; Acvr2a; rActR-II; TactrII; type II activin receptor |
| Gene ID (Entrez) | 92 |
| Formulation | 50 mM tris HCl with 0.02% NP-40, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5 |
| Protein Tag | GST-tag |
| Species | Human |
| Recombinant | Recombinant |
461
Invitrogen™ Human KDR (VEGFR2), His Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Conjugate | Unconjugated |
|---|---|
| Form | Liquid |
| Common Name | FLK1 (VEGF Receptor 2) |
| Molecular Weight (g/mol) | 68.4 kDa |
| Concentration | See Label |
| Expression System | Insect cells |
| For Use With (Application) | Kinase Assay |
| Name | Human KDR (VEGFR2), His Tag |
| Accession Number | P35968 |
| Gene Alias | 6130401C07; CD309; CD309 antigen; fetal liver kinase 1; fetal liver kinase-1; FLK1; Flk-1; FLK1 kinase insert domain receptor (a type III receptor tyrosine kinase) (VEGF receptor 2); FLK1 kinase insert domain receptor (VEGF receptor 2); flk-1 type VEGF receptor; KDR; kinase insert domain protein receptor; kinase insert domain receptor; kinase insert domain receptor (a type III receptor tyrosine kinase); kinase NYK; Krd-1; Ly73; protein-tyrosine kinase receptor flk-1; sCD309; soluble CD309; soluble vascular endothelial growth factor receptor 2; soluble VEGFR 2; soluble VEGFR2; sVEGFR-2; tyrosine kinase growth factor receptor; vascular endotheial growth factor 2; vascular endothelial growth factor receptor 2; vascular endothelial growth factor receptor- 2; vascular endothelial growth factor receptor-2; vascular endothelial growth factor receptor-3; VEGF R2; VEGF receptor-2; VEGFR; VEGFR2; VEGFR-2 |
| Gene ID (Entrez) | 3791 |
| Protein Tag | His-tag |
| Species | Human |
| Recombinant | Recombinant |
462
Invitrogen™ Human PIM1, His Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | For research use only. Not for use in diagnostic procedures |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| Molecular Weight (g/mol) | 40.7 kDa |
| Formulation | 50 mM tris HCl with 0.05% Triton X-100, 0.5 mM EDTA, 2 mM DTT, 50% glycerol, 500 mM NaCl and no preservative; pH 7.5 |
| Sequence | Full length |
| Concentration | See Label |
| For Use With (Application) | Kinase Assay |
| Name | Human PIM1, His Tag |
| Recombinant | Recombinant |
463
Invitrogen™ Human RPS6KA3 (RSK2), His Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Shipping Condition | Dry Ice |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| pH Range | 7.5 |
| Common Name | RSK2 |
| Molecular Weight (g/mol) | 86.3 kDa |
| KinaseFamily | RSK (RPS6K) Kinase Family |
| Gene Symbol | RPS6KA3 |
| Sequence | Full length |
| Storage Requirements | -80°C, Avoid Freeze/Thaw Cycles |
| Concentration | See Label |
| Expression System | Baculovirus |
| For Use With (Application) | Kinase Assay |
| Name | Human RPS6KA3 (RSK2), His Tag |
| Accession Number | P51812 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | 90 kDa ribosomal protein S6 kinase 3; C130006E23; CLS; HU-3; Insulin-stimulated protein kinase 1; ISPK1; ISPK-1; MAP kinase-activated protein kinase 1b; MAPK-activated protein kinase 1b; MAPKAP kinase 1b; MAPKAPK1B; MAPKAPK-1b; MPK-9; MRX19; p90-RSK 3; p90-RSK2; p90RSK3; pp90RSK2; RGD1563860; ribosomal protein S6 kinase 2; ribosomal protein S6 kinase A3; ribosomal protein S6 kinase alpha-3; ribosomal protein S6 kinase polypeptide 3; ribosomal protein S6 kinase, 90kDa, polypeptide 3; ribosomal S6 kinase 2; Rps6ka3; Rps6ka-rs1; RSK; Rsk2; RSK-2; S6K-alpha3; S6K-alpha-3 |
| Product Type | Protein |
| Gene ID (Entrez) | 6197 |
| Formulation | 50mM tris with 2mM DTT, 150mM NaCl, 0.05mM EDTA, 50% glycerol, 0.05% Triton X-100 and no preservative; pH 7.5 |
| Protein Tag | His-tag |
| Species | Human |
| Recombinant | Recombinant |
464
Invitrogen™ Human TEC, His Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Shipping Condition | Dry Ice |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| pH Range | 7.5 |
| Common Name | TEC |
| Molecular Weight (g/mol) | 76.4 kDa |
| KinaseFamily | TEC Kinase Family |
| Gene Symbol | Tec |
| Kinase Group | Tyrosine Kinases |
| Sequence | Full length |
| Storage Requirements | -80°C, Avoid Freeze/Thaw Cycles |
| Concentration | See Label |
| Expression System | Baculovirus |
| For Use With (Application) | Kinase Assay |
| Name | Human TEC, His Tag |
| Accession Number | P42680 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | cytoplasmic tyrosine kinase, Dscr28C related; MGC126760; MGC126762; PSCTK4; TEC; tec protein tyrosine kinase; tyrosine-protein kinase Tec |
| Product Type | Protein |
| Gene ID (Entrez) | 100124696, 7006 |
| Formulation | 20mM tris with 150mM NaCl, 50% glycerol, 0.5mM EDTA, 2mM DTT, 0.05% Triton X-100 and no preservative; pH 7.5 |
| Protein Tag | His-tag |
| Species | Human |
| Recombinant | Recombinant |
465
Invitrogen™ Human CLK1, GST Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Shipping Condition | Dry Ice |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| pH Range | 7.5 |
| Common Name | CLK1 |
| Molecular Weight (g/mol) | 70.1 kDa |
| KinaseFamily | CLK Kinase Family |
| Gene Symbol | CLK1 |
| Sequence | 129-484 |
| Storage Requirements | -80°C, Avoid Freeze/Thaw Cycles |
| Concentration | See Label |
| Expression System | E. coli |
| For Use With (Application) | Kinase Assay |
| Name | Human CLK1, GST Tag |
| Accession Number | P49759 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | CDC like kinase 1; CDC28/CDC2-like kinase; CDC-like kinase 1; CLK; CLK/STY; CLK1; Dual specificity protein kinase CLK1; Protein kinase CLK1; protein kinase STY; protein tyrosine kinase STY; Sty |
| Protein Form | Recombinant, Catalytic |
| Product Type | Protein |
| Gene ID (Entrez) | 1195 |
| Formulation | 50mM tris with 0.05mM EDTA, 0.05% Triton X-100, 50% glycerol, 2mM DTT, 150mM NaCl and no preservative; pH 7.5 |
| Protein Tag | GST-tag |
| Species | Human |
| Recombinant | Recombinant |